DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and Ubl7

DIOPT Version :10

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_081362.2 Gene:Ubl7 / 69459 MGIID:1916709 Length:380 Species:Mus musculus


Alignment Length:54 Identity:24/54 - (44%)
Similarity:33/54 - (61%) Gaps:4/54 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 SIENVKARIHDK--EGIP-PDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR 224
            ||..:|..|..|  |.:| |:...||:.|::|:|.:||..|.||..||:| |||
Mouse    39 SISFLKQLIAGKLQESVPDPELIDLIYCGRKLKDDQTLDFYGIQPGSTVH-VLR 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130
Ubl1_cv_Nsp3_N-like 77..152 CDD:475130
Ubl_ubiquitin 153..228 CDD:340501 24/54 (44%)
Ubl1_cv_Nsp3_N-like 229..296 CDD:475130
Ubl7NP_081362.2 Ubl_UBL7 7..98 CDD:340513 24/54 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..313
UBA_UBL7 <346..375 CDD:270511
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.