powered by:
Protein Alignment CG11700 and RAD23A
DIOPT Version :9
Sequence 1: | NP_572306.1 |
Gene: | CG11700 / 31564 |
FlyBaseID: | FBgn0029856 |
Length: | 301 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_024307399.1 |
Gene: | RAD23A / 5886 |
HGNCID: | 9812 |
Length: | 382 |
Species: | Homo sapiens |
Alignment Length: | 66 |
Identity: | 24/66 - (36%) |
Similarity: | 39/66 - (59%) |
Gaps: | 3/66 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 231 IFVKTLTGKTITLEVEPSDTIKHVKARIH---DKDGIPPDHQRLIFAGKQLEDGRTLSDYNIQKE 292
|.:|||..:|..:.:||.:|:|.:|.:|. .:|..|...|:||:|||.|.|...:.||.|.::
Human 5 ITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEK 69
Fly 293 S 293
:
Human 70 N 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.