DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and RAD23A

DIOPT Version :10

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_005044.1 Gene:RAD23A / 5886 HGNCID:9812 Length:363 Species:Homo sapiens


Alignment Length:66 Identity:24/66 - (36%)
Similarity:39/66 - (59%) Gaps:3/66 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 IFVKTLTGKTITLEVEPSDTIKHVKARIH---DKDGIPPDHQRLIFAGKQLEDGRTLSDYNIQKE 292
            |.:|||..:|..:.:||.:|:|.:|.:|.   .:|..|...|:||:|||.|.|...:.||.|.::
Human     5 ITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEK 69

  Fly   293 S 293
            :
Human    70 N 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130
Ubl1_cv_Nsp3_N-like 77..152 CDD:475130
Ubl_ubiquitin 153..228 CDD:340501
Ubl1_cv_Nsp3_N-like 229..296 CDD:475130 24/66 (36%)
RAD23ANP_005044.1 rad23 3..361 CDD:273167 24/66 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..160
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..227
HIV-1 vpr binding 319..363
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.