powered by:
Protein Alignment CG11700 and AgaP_AGAP001757
DIOPT Version :9
Sequence 1: | NP_572306.1 |
Gene: | CG11700 / 31564 |
FlyBaseID: | FBgn0029856 |
Length: | 301 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001689324.2 |
Gene: | AgaP_AGAP001757 / 5667650 |
VectorBaseID: | AGAP001757 |
Length: | 1634 |
Species: | Anopheles gambiae |
Alignment Length: | 74 |
Identity: | 28/74 - (37%) |
Similarity: | 42/74 - (56%) |
Gaps: | 0/74 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 155 IFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTL 219
|.|:||||....:.|...|::..:|:.|...||||..||.|::..|:|.|...:.|..:.|.|.:
Mosquito 8 IIVETLTGSEFEVTVNDRDTVGYLKSEIQKYEGIPISQQHLLYNHKELSDAMEMKDIPLVKGSRV 72
Fly 220 HLVLRLRGG 228
.|||.::||
Mosquito 73 KLVLGMKGG 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.