DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11700 and ubtd1a

DIOPT Version :9

Sequence 1:	NP_572306.1	Gene:	CG11700 / 31564	FlyBaseID:	FBgn0029856	Length:	301	Species:	Drosophila melanogaster
Sequence 2:	XP_005156917.1	Gene:	ubtd1a / 563264	ZFINID:	ZDB-GENE-070424-93	Length:	230	Species:	Danio rerio

Alignment Length:	70	Identity:	25/70 - (35%)
Similarity:	40/70 - (57%)	Gaps:	0/70 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     2 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKEST 66
            |:.|:..|||.:.|.|..:|:|..:|.::|.:|:....|||..|.||.|.:...|.|..|||:..
Zfish   154 QLKVRLSTGKDLRLSVTMADSIRQLKKQLQIQEDIDTAHQRWFFSGKLLTDKTRLQDTKIQKDFV 218

  Fly    67 IYLVL 71
            |.:::
Zfish   219 IQVIV 223

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11700	NP_572306.1	Ubiquitin	1..76	CDD:176398	25/70 (36%)
		UBQ	1..72	CDD:214563	25/70 (36%)
		Ubiquitin	77..152	CDD:176398
		UBQ	77..148	CDD:214563
		Ubiquitin	153..228	CDD:176398
		UBQ	153..224	CDD:214563
		UBQ	229..296	CDD:214563
		UBQ	229..296	CDD:294102
ubtd1a	XP_005156917.1	UBD	29..133	CDD:293064
		UBQ	153..224	CDD:214563	25/70 (36%)
		UBQ	155..224	CDD:294102	24/69 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910