DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and faub

DIOPT Version :10

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001017866.2 Gene:faub / 550564 ZFINID:ZDB-GENE-050417-416 Length:133 Species:Danio rerio


Alignment Length:77 Identity:24/77 - (31%)
Similarity:47/77 - (61%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 MQIFVKTLTGKTI-TLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 216
            ||:||:   |::: ::::..|:::.::||:|...||:..|.|.:..:|..|||...:....|::.
Zfish     1 MQLFVR---GQSLHSVQLNGSETVAHIKAQIEALEGLACDDQIISLSGIPLEDDALICQSGIEEF 62

  Fly   217 STLHLVLRLRGG 228
            :||.:..||.||
Zfish    63 NTLEVSSRLLGG 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130
Ubl1_cv_Nsp3_N-like 77..152 CDD:475130
Ubl_ubiquitin 153..228 CDD:340501 22/75 (29%)
Ubl1_cv_Nsp3_N-like 229..296 CDD:475130 24/77 (31%)
faubNP_001017866.2 Ubl_FUBI 1..74 CDD:340491 22/75 (29%)
Ribosomal_S30 75..132 CDD:398432 24/77 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.