powered by:
Protein Alignment CG11700 and ubl7a
DIOPT Version :9
Sequence 1: | NP_572306.1 |
Gene: | CG11700 / 31564 |
FlyBaseID: | FBgn0029856 |
Length: | 301 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001017765.1 |
Gene: | ubl7a / 550462 |
ZFINID: | ZDB-GENE-050417-285 |
Length: | 379 |
Species: | Danio rerio |
Alignment Length: | 64 |
Identity: | 25/64 - (39%) |
Similarity: | 34/64 - (53%) |
Gaps: | 13/64 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 244 EVEPSD---------TIKH-VKARIHDKDGIP-PDHQRLIFAGKQLEDGRTLSDYNIQKESTLH 296
|.||.| |:|. |.|:| .|.|| |:...|::.|::|:|..||..|.||..||:|
Zfish 27 EAEPGDVPPGEYRVSTLKQLVSAQI--PDAIPDPELIELVYCGRKLKDDLTLESYGIQSGSTVH 88
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.