DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and Ubqln2

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_061268.2 Gene:Ubqln2 / 54609 MGIID:1860283 Length:638 Species:Mus musculus


Alignment Length:98 Identity:30/98 - (30%)
Similarity:46/98 - (46%) Gaps:11/98 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 MQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 217
            :::.|||...|. ...|..:.:::..|..|..:.....||..||||||.|:|..||..:.|....
Mouse    33 IKVTVKTPKEKE-EFAVPENSTVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLMQHGIHDGL 96

  Fly   218 TLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDT 250
            |:|||::.:...|       |:..|   :||.|
Mouse    97 TVHLVIKSQNRPQ-------GQATT---QPSTT 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398
UBQ 77..148 CDD:214563
Ubiquitin 153..228 CDD:176398 24/74 (32%)
UBQ 153..224 CDD:214563 24/70 (34%)
UBQ 229..296 CDD:214563 6/22 (27%)
UBQ 229..296 CDD:294102 6/22 (27%)
Ubqln2NP_061268.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
UBQ 33..103 CDD:214563 24/70 (34%)
hPLIC_N 33..103 CDD:176403 24/70 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..158 6/23 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..364
STI1 396..440 CDD:128966
11 X 3 AA tandem repeats P-X-X 505..537
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 528..570
UBA_PLICs 595..634 CDD:270582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.