DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11700 and RGD1562433

DIOPT Version :9

Sequence 1:	NP_572306.1	Gene:	CG11700 / 31564	FlyBaseID:	FBgn0029856	Length:	301	Species:	Drosophila melanogaster
Sequence 2:	NP_001071146.1	Gene:	RGD1562433 / 499222	RGDID:	1562433	Length:	510	Species:	Rattus norvegicus

Alignment Length:	139	Identity:	37/139 - (26%)
Similarity:	51/139 - (36%)	Gaps:	39/139 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly   122 GGKHLENGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSD----------SIE 176
            |...|.:||         ||:..::       ::.|||           |.|          ::.
  Rat     9 GDSQLVSGR---------ESSSRII-------RVSVKT-----------PQDCQEFFLAENSNVH 46

  Fly   177 NVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT- 240
            ..|.:|........|:..||:.||.|:|...||...|...||:|.|:|.|........||.|.|
  Rat    47 RFKKQISKYLHCDTDRLVLIYTGKILQDQDILSQRGILDGSTVHAVVRSRLKGSACTGTLAGPTG 111

  Fly   241 -ITLEVEPS 248
             .|...|||
  Rat   112 HCTHRSEPS 120

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11700	NP_572306.1	Ubiquitin	1..76	CDD:176398
		UBQ	1..72	CDD:214563
		Ubiquitin	77..152	CDD:176398	6/29 (21%)
		UBQ	77..148	CDD:214563	6/25 (24%)
		Ubiquitin	153..228	CDD:176398	23/84 (27%)
		UBQ	153..224	CDD:214563	21/80 (26%)
		UBQ	229..296	CDD:214563	8/22 (36%)
		UBQ	229..296	CDD:294102	8/22 (36%)
RGD1562433	NP_001071146.1	UBQ	24..94	CDD:214563	21/87 (24%)
		UBQ	24..94	CDD:294102	21/87 (24%)
		UBA_PLICs	467..506	CDD:270582
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900