DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and NEDD8

DIOPT Version :10

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_006147.1 Gene:NEDD8 / 4738 HGNCID:7732 Length:81 Species:Homo sapiens


Alignment Length:76 Identity:45/76 - (59%)
Similarity:58/76 - (76%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 MQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 217
            |.|.|||||||.|.:::||:|.:|.:|.|:.:||||||.|||||::|||:.|.:|.:||.|...|
Human     1 MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGS 65

  Fly   218 TLHLVLRLRGG 228
            .|||||.||||
Human    66 VLHLVLALRGG 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130
Ubl1_cv_Nsp3_N-like 77..152 CDD:475130
Ubl_ubiquitin 153..228 CDD:340501 43/74 (58%)
Ubl1_cv_Nsp3_N-like 229..296 CDD:475130 45/76 (59%)
NEDD8NP_006147.1 Ubl_NEDD8 3..76 CDD:340504 42/72 (58%)
Interaction with UBE1C. /evidence=ECO:0000269|PubMed:14690597 70..72 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.