DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and Rad23

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster


Alignment Length:242 Identity:60/242 - (24%)
Similarity:98/242 - (40%) Gaps:53/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEH----QRLIFGGKHLENGRTLSDYNI 61
            |.|.:|.|..:|.|:|..|..|:..:|.||  .||..||:    |:||:.|..|.:.||:..||:
  Fly     1 MIITIKNLQQQTFTIEFAPEKTVLELKKKI--FEERGPEYVAEKQKLIYAGVILTDDRTVGSYNV 63

  Fly    62 QKESTIYLVLRLRGGM----QIFVKTLTGKTITLEVE-------------PSDTIENVKAKIQDK 109
            .::..|.::|......    |:.||.....|.|.:.:             ||.|  |.:..:..:
  Fly    64 DEKKFIVVMLTRDSSSSNRNQLSVKESNKLTSTDDSKQSMPCEEANHTNSPSST--NTEDSVLSR 126

  Fly   110 EENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVE---P 171
            |..|.....||  |:       |:..::|..:...|::    |.:.      .:|:...||   |
  Fly   127 ETRPLSSDELI--GE-------LAQASLQSRAESNLLM----GDEY------NQTVLSMVEMGYP 172

  Fly   172 SDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST 218
            .:.:|...|..::.   |......:..|...|:|   :.||...|||
  Fly   173 REQVERAMAASYNN---PERAVEYLINGIPAEEG---TFYNRLNEST 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 27/78 (35%)
UBQ 1..72 CDD:214563 26/74 (35%)
Ubiquitin 77..152 CDD:176398 17/91 (19%)
UBQ 77..148 CDD:214563 17/87 (20%)
Ubiquitin 153..228 CDD:176398 15/69 (22%)
UBQ 153..224 CDD:214563 15/69 (22%)
UBQ 229..296 CDD:214563
UBQ 229..296 CDD:294102
Rad23NP_001259052.1 rad23 1..413 CDD:273167 60/242 (25%)
RAD23_N 1..76 CDD:176400 27/76 (36%)
UBA1_Rhp23p_like 153..199 CDD:270561 10/58 (17%)
XPC-binding 242..296 CDD:286376
UBA2_HR23A 371..411 CDD:270610
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.