| Sequence 1: | NP_572306.1 | Gene: | CG11700 / 31564 | FlyBaseID: | FBgn0029856 | Length: | 301 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001002718.2 | Gene: | ubtd2 / 436991 | ZFINID: | ZDB-GENE-040718-473 | Length: | 244 | Species: | Danio rerio |
| Alignment Length: | 201 | Identity: | 42/201 - (20%) |
|---|---|---|---|
| Similarity: | 74/201 - (36%) | Gaps: | 55/201 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 26 VKAKIQDKEENPPEHQRLIFGGKH--LENGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKT 88
Fly 89 ITLEVE-PSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIYLVLRLRGG 152
Fly 153 MQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 217
Fly 218 TLHLVL 223 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG11700 | NP_572306.1 | Ubiquitin | 1..76 | CDD:176398 | 12/51 (24%) |
| UBQ | 1..72 | CDD:214563 | 11/47 (23%) | ||
| Ubiquitin | 77..152 | CDD:176398 | 10/75 (13%) | ||
| UBQ | 77..148 | CDD:214563 | 10/71 (14%) | ||
| Ubiquitin | 153..228 | CDD:176398 | 20/71 (28%) | ||
| UBQ | 153..224 | CDD:214563 | 20/71 (28%) | ||
| UBQ | 229..296 | CDD:214563 | |||
| UBQ | 229..296 | CDD:294102 | |||
| ubtd2 | NP_001002718.2 | UBD | 32..136 | CDD:293064 | 15/68 (22%) |
| UBQ | 157..227 | CDD:214563 | 20/70 (29%) | ||
| UBQ | 158..227 | CDD:294102 | 19/69 (28%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||