DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and C16C8.25

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001364524.1 Gene:C16C8.25 / 43578469 WormBaseID:WBGene00305092 Length:165 Species:Caenorhabditis elegans


Alignment Length:92 Identity:17/92 - (18%)
Similarity:41/92 - (44%) Gaps:18/92 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLT 85
            :|:|..:..::.:::...|.::..|  ||        :|.|::|     ..:::......::.|.
 Worm    39 ETLEMSQKILKKQDQFQDEMKQEFF--KH--------NYKIKQE-----FQKIQEKQNKLIENLM 88

  Fly    86 GKTITLEVEPSDT---IENVKAKIQDK 109
            .:..|::.|.:.|   |..:.||..|:
 Worm    89 SELKTVKAELNVTKNQINGLLAKNSDE 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 9/54 (17%)
UBQ 1..72 CDD:214563 9/50 (18%)
Ubiquitin 77..152 CDD:176398 8/36 (22%)
UBQ 77..148 CDD:214563 8/36 (22%)
Ubiquitin 153..228 CDD:176398
UBQ 153..224 CDD:214563
UBQ 229..296 CDD:214563
UBQ 229..296 CDD:294102
C16C8.25NP_001364524.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.