DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and CG10694

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster


Alignment Length:278 Identity:52/278 - (18%)
Similarity:110/278 - (39%) Gaps:45/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEE--NPPEHQRLIFGGKHLENGRTLSDYNIQK 63
            |::.::.|..:|||||:..|..:..:|.|:.:..|  .|.|:.:||:.|:.:|:...||:|.|.:
  Fly     1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAE 65

  Fly    64 ESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDTI---------------ENVKAKIQDKEENP 113
            :..|.|:               ||....:..|.:.:               |:|...:...::..
  Fly    66 DKIIVLM---------------GKKKVDKSSPEEKVAPTPPLAAGPNVLRTEDVVPSLAPNDQWV 115

  Fly   114 PEHQRLIFGGKHLENGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIENV 178
            .:...:.:|.:.:.:....| :|..:.:..||:    .|:...|.:..|......|:.||.::.:
  Fly   116 SDLMSMGYGEEEVRSALRAS-FNHPERAIEYLI----NGIPQEVVSEQGLAAIPSVQTSDQLQQL 175

  Fly   179 KA-----RIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG 238
            .|     |:.:.....|:....:.......|..|...:...:|..::::   .||.......:..
  Fly   176 MADLNITRMREMINQNPELIHRLMNRLAETDPATFEVFQRNQEELMNMI---SGGASRTPNEIEH 237

  Fly   239 KTITLEVEPSDTIKHVKA 256
            ..|||..|.:..:..::|
  Fly   238 LQITLTAEETAAVGRLEA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 23/76 (30%)
UBQ 1..72 CDD:214563 23/72 (32%)
Ubiquitin 77..152 CDD:176398 10/89 (11%)
UBQ 77..148 CDD:214563 10/85 (12%)
Ubiquitin 153..228 CDD:176398 11/79 (14%)
UBQ 153..224 CDD:214563 11/75 (15%)
UBQ 229..296 CDD:214563 5/28 (18%)
UBQ 229..296 CDD:294102 5/28 (18%)
CG10694NP_651212.1 rad23 1..284 CDD:273167 52/278 (19%)
UBQ 1..76 CDD:294102 25/89 (28%)
UBA1_Rad23_like 110..148 CDD:270466 5/42 (12%)
XPC-binding 172..227 CDD:286376 6/57 (11%)
UBA2_Rad23_like 245..282 CDD:270467 2/11 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.