powered by:
Protein Alignment CG11700 and CG3223
DIOPT Version :9
Sequence 1: | NP_572306.1 |
Gene: | CG11700 / 31564 |
FlyBaseID: | FBgn0029856 |
Length: | 301 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_649758.1 |
Gene: | CG3223 / 40947 |
FlyBaseID: | FBgn0037538 |
Length: | 415 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 13/71 - (18%) |
Similarity: | 29/71 - (40%) |
Gaps: | 20/71 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 156 FVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH 220
::|.:..|.:.|:.:.| :..:|..|:.|||..|| :..:|..:.:|
Fly 29 YLKAVVTKEMHLQFDAS-------------------ELEIIHHGRVLEDADTL-NRTLQPNAVIH 73
Fly 221 LVLRLR 226
...:::
Fly 74 CFQKIK 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.