DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and CG3223

DIOPT Version :10

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_649758.1 Gene:CG3223 / 40947 FlyBaseID:FBgn0037538 Length:415 Species:Drosophila melanogaster


Alignment Length:71 Identity:13/71 - (18%)
Similarity:29/71 - (40%) Gaps:20/71 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 FVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH 220
            ::|.:..|.:.|:.:.|                   :..:|..|:.|||..|| :..:|..:.:|
  Fly    29 YLKAVVTKEMHLQFDAS-------------------ELEIIHHGRVLEDADTL-NRTLQPNAVIH 73

  Fly   221 LVLRLR 226
            ...:::
  Fly    74 CFQKIK 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130
Ubl1_cv_Nsp3_N-like 77..152 CDD:475130
Ubl_ubiquitin 153..228 CDD:340501 13/71 (18%)
Ubl1_cv_Nsp3_N-like 229..296 CDD:475130
CG3223NP_649758.1 Ubl_ubiquitin_like 9..75 CDD:340559 13/65 (20%)
UBA_like_SF 373..410 CDD:473871
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.