DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11700 and ubqln4

DIOPT Version :9

Sequence 1:	NP_572306.1	Gene:	CG11700 / 31564	FlyBaseID:	FBgn0029856	Length:	301	Species:	Drosophila melanogaster
Sequence 2:	NP_998521.2	Gene:	ubqln4 / 334337	ZFINID:	ZDB-GENE-030131-6269	Length:	599	Species:	Danio rerio

Alignment Length:	94	Identity:	29/94 - (30%)
Similarity:	45/94 - (47%)	Gaps:	10/94 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   131 TLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRL 195
            |.::.|....:||         :::.|||...|. .:.:....|:...|..|..:.....||..|
Zfish    13 TNTEENAAASATI---------IKVTVKTPKDKE-EIAIAEDASVAQFKEEISKRFKAKQDQLVL 67

  Fly   196 IFAGKQLEDGRTLSDYNIQKESTLHLVLR 224
            |||||.|:||.||..:.|:...|:|||::
Zfish    68 IFAGKILKDGDTLGQHGIKDGLTVHLVIK 96

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11700	NP_572306.1	Ubiquitin	1..76	CDD:176398
		UBQ	1..72	CDD:214563
		Ubiquitin	77..152	CDD:176398	4/20 (20%)
		UBQ	77..148	CDD:214563	4/16 (25%)
		Ubiquitin	153..228	CDD:176398	25/72 (35%)
		UBQ	153..224	CDD:214563	25/70 (36%)
		UBQ	229..296	CDD:214563
		UBQ	229..296	CDD:294102
ubqln4	NP_998521.2	UBQ	26..96	CDD:214563	25/70 (36%)
		hPLIC_N	26..96	CDD:176403	25/70 (36%)
		STI1	186..223	CDD:128966
		UBA_PLICs	556..595	CDD:270582
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900