DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and CG31528

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_730833.1 Gene:CG31528 / 318785 FlyBaseID:FBgn0051528 Length:344 Species:Drosophila melanogaster


Alignment Length:64 Identity:16/64 - (25%)
Similarity:32/64 - (50%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 TGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR 224
            :|:..|:.:..::.|.|::..:..:......:..|:|||:.|.|..|:....|....|:|:|.|
  Fly    14 SGRVETVTLRQNELIRNLRVLVAVRFEQAISRIILVFAGQVLSDEGTIDSRGIVSGVTVHVVCR 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398
UBQ 77..148 CDD:214563
Ubiquitin 153..228 CDD:176398 16/64 (25%)
UBQ 153..224 CDD:214563 15/62 (24%)
UBQ 229..296 CDD:214563
UBQ 229..296 CDD:294102
CG31528NP_730833.1 UBQ 7..77 CDD:294102 15/62 (24%)
UBA_like_SF 299..335 CDD:304366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.