DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and Ubqln4

DIOPT Version :10

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001101158.1 Gene:Ubqln4 / 310633 RGDID:1308273 Length:595 Species:Rattus norvegicus


Alignment Length:75 Identity:27/75 - (36%)
Similarity:42/75 - (56%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 RGGMQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214
            |..:::.|||...|...|..:.: |::..|..|..:.....||..||||||.|:||.||:.:.|:
  Rat    10 RPQIRVTVKTPKDKEEILICDQA-SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLNQHGIK 73

  Fly   215 KESTLHLVLR 224
            ...|:|||::
  Rat    74 DGLTVHLVIK 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130
Ubl1_cv_Nsp3_N-like 77..152 CDD:475130 1/1 (100%)
Ubl_ubiquitin 153..228 CDD:340501 26/72 (36%)
Ubl1_cv_Nsp3_N-like 229..296 CDD:475130
Ubqln4NP_001101158.1 Ubl_PLICs 11..83 CDD:340506 26/72 (36%)
PRK10856 <84..>151 CDD:236776 27/75 (36%)
STI1 186..234 CDD:450205
STI1 216..260 CDD:450205
STI1 <371..407 CDD:450205
UBA_PLICs 552..591 CDD:270582
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.