DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and Oasl2

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001009682.1 Gene:Oasl2 / 304549 RGDID:1307351 Length:511 Species:Rattus norvegicus


Alignment Length:174 Identity:48/174 - (27%)
Similarity:81/174 - (46%) Gaps:12/174 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 TLSDYNIQKESTIYLVLRLRGG--MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQ 117
            |...:|:|.....|    |||.  :|:.||....:...|...|...|..:||||: |..|.....
  Rat   339 TADRWNVQV
SIAHY----LRGARDVQVTVKQTGREEWILLTNPHSPIRKLKAKIK-KRMNLCGEL 398

  Fly   118 RLIF---GGKH--LENGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIEN 177
            |:.|   ||:.  |...:|||||.|..:..|.::......:|:||:...|:.....::|..:|.:
  Rat   399 RISFQEPGGERQPLSGRKTLSDYGIFSKVNIRVM
ETFPPEIQVFVRYPGGQNKPFAIDPDATILS 463

  Fly   178 VKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 221
            :..:|.:..|...:...|:|.|::|:|...|::..|:...|:.|
  Rat   464 LWEKIEEDGGPCTEDWVLLFEGEELDDDDNLAELQIKDCDTIQL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 6/20 (30%)
UBQ 1..72 CDD:214563 4/16 (25%)
Ubiquitin 77..152 CDD:176398 24/79 (30%)
UBQ 77..148 CDD:214563 24/75 (32%)
Ubiquitin 153..228 CDD:176398 17/69 (25%)
UBQ 153..224 CDD:214563 17/69 (25%)
UBQ 229..296 CDD:214563
UBQ 229..296 CDD:294102
Oasl2NP_001009682.1 NT_2-5OAS_ClassI-CCAase 29..214 CDD:143390
OAS1_C 170..347 CDD:402171 2/7 (29%)
Ubl1_OASL 359..432 CDD:340509 24/73 (33%)
Ubl2_OASL 438..509 CDD:340520 17/70 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.