DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and Isg15

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001100170.1 Gene:Isg15 / 298693 RGDID:1310312 Length:161 Species:Rattus norvegicus


Alignment Length:150 Identity:42/150 - (28%)
Similarity:73/150 - (48%) Gaps:2/150 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 VKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIF-GGKHLENGRTLSDYNIQKESTIY 144
            ||.|.||...:.:..|..:..:|.::..|...|...|||.. .|:.|::|..|....:...||:.
  Rat     7 VKMLGGKEFLVSMTNSMMLSELKKQVAQKSGVPAFQQRLAHQSGEMLQDGVALIRQGLSSGSTVM 71

  Fly   145 LVL-RLRGGMQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTL 208
            |:: .....:.|.|:...|::...||:.:.::|.:..::...|.:..||..|.|.|:.:||...|
  Rat    72 LMVENCS
HPLSILVRNERGRSNVYEVQLTQTVEVLMRQVSQHEQVSQDQFWLSFNGRPMEDKEPL 136

  Fly   209 SDYNIQKESTLHLVLRLRGG 228
            .:|.:....|:.:.||||||
  Rat   137 GEYGLTPHCTVIMNLRLRGG 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398 19/72 (26%)
UBQ 77..148 CDD:214563 19/68 (28%)
Ubiquitin 153..228 CDD:176398 21/74 (28%)
UBQ 153..224 CDD:214563 17/70 (24%)
UBQ 229..296 CDD:214563 41/149 (28%)
UBQ 229..296 CDD:294102 41/149 (28%)
Isg15NP_001100170.1 UBQ 1..78 CDD:294102 19/70 (27%)
UBQ 3..75 CDD:214563 19/67 (28%)
UBQ 81..152 CDD:214563 17/70 (24%)
UBQ 83..156 CDD:294102 21/72 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.