DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and Rad23b

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001020446.1 Gene:Rad23b / 298012 RGDID:1562958 Length:415 Species:Rattus norvegicus


Alignment Length:68 Identity:25/68 - (36%)
Similarity:42/68 - (61%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 MQIFVKTLTGKTITLEVEPSDTIKHVKARIHD---KDGIPPDHQRLIFAGKQLEDGRTLSDYNIQ 290
            ||:.:|||..:|..::::|.:|:|.:|.:|..   ||..|...|:||:|||.|.|...|.:|.|.
  Rat     1 MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILSDDTALKEYKID 65

  Fly   291 KES 293
            :::
  Rat    66 EKN 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398
UBQ 77..148 CDD:214563
Ubiquitin 153..228 CDD:176398
UBQ 153..224 CDD:214563
UBQ 229..296 CDD:214563 25/68 (37%)
UBQ 229..296 CDD:294102 25/68 (37%)
Rad23bNP_001020446.1 rad23 1..413 CDD:273167 25/68 (37%)
RAD23_N 1..78 CDD:176400 25/68 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..175
MSA-2c <125..186 CDD:289042
UBA1_Rad23 189..228 CDD:270560
XPC-binding 276..331 CDD:286376
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..355
UBA2_HR23B 371..415 CDD:270611
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.