DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and Fau

DIOPT Version :10

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_063144026.1 Gene:Fau / 29752 RGDID:61938 Length:188 Species:Rattus norvegicus


Alignment Length:76 Identity:27/76 - (35%)
Similarity:43/76 - (56%) Gaps:2/76 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 MQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 217
            ||:||:  ..:..||||...:::..:||.:...|||.|:.|.::.||..|||..||....::..:
  Rat     1 MQLFVR--AQELHTLEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGSPLEDEATLGQCGVEALT 63

  Fly   218 TLHLVLRLRGG 228
            ||.:..|:.||
  Rat    64 TLEVAGRMLGG 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130
Ubl1_cv_Nsp3_N-like 77..152 CDD:475130
Ubl_ubiquitin 153..228 CDD:340501 25/74 (34%)
Ubl1_cv_Nsp3_N-like 229..296 CDD:475130 27/76 (36%)
FauXP_063144026.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.