DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and Ubd

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_445751.2 Gene:Ubd / 29168 RGDID:69418 Length:161 Species:Rattus norvegicus


Alignment Length:153 Identity:47/153 - (30%)
Similarity:73/153 - (47%) Gaps:20/153 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIYLVLRLRGGM 153
            :|.:...||.::.:...|:.:.:...:.|.|:...|.|:..|.||.|.|.||:||:|.|::    
  Rat    16 MTFDTTMSDKVKKINEHIRSQTKVSVQDQILLLDSKILKPHRALSSYGIDKENTIHLTLK
V---- 76

  Fly   154 QIFVKTL-------------TGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDG 205
               ||..             .|:...|.|..|.|:..||..|.:...:||.:|.:...||:||||
  Rat    77 ---VKPSDEELPLSLVESGDEGQRHLLRVRRSSSVAQVKEMIENVTAVPPKKQFVNCNGKRLEDG 138

  Fly   206 RTLSDYNIQKESTLHLVLRLRGG 228
            :.::||||:..|.|.|.....||
  Rat   139 KIMADYNIKSGSLLFLTAHCIGG 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398 19/62 (31%)
UBQ 77..148 CDD:214563 18/58 (31%)
Ubiquitin 153..228 CDD:176398 26/87 (30%)
UBQ 153..224 CDD:214563 26/83 (31%)
UBQ 229..296 CDD:214563 47/153 (31%)
UBQ 229..296 CDD:294102 47/153 (31%)
UbdNP_445751.2 UBQ 8..75 CDD:214563 18/58 (31%)
UBQ 17..75 CDD:294102 18/57 (32%)
UBQ 92..154 CDD:214563 23/61 (38%)
ubiquitin 95..154 CDD:278661 23/58 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54325
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.