DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and AT1G53950

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001319219.1 Gene:AT1G53950 / 28717351 AraportID:AT1G53950 Length:144 Species:Arabidopsis thaliana


Alignment Length:164 Identity:67/164 - (40%)
Similarity:86/164 - (52%) Gaps:41/164 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LRLRGGMQIFVKTLTGKTITLEVE-PSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSD 134
            :::...|.|.:|||.||.|.|||| .|:||                                  |
plant    14 IKVEFAMHISIKTLEGKRIKLEVEDSSNTI----------------------------------D 44

  Fly   135 YNIQKESTIYLVLRL-----RGG-MQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQ 193
            ..|..|.|..||:.|     .|. |.||:|||||:|.|.||:.||:|..:||:..:|||||.:||
plant    45 LKIHGEPTRELVVDLSPTPDTGAIMMIFIKTLTGRTNTYEVKGSDTIRELKAKHEEKEGIPVEQQ 109

  Fly   194 RLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG 227
            ||||.|:.|||.:.:|||||:.|||||:.|...|
plant   110 RLIFQGRVLEDSKAISDYNIKHESTLHITLHQCG 143

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 0/4 (0%)