DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and Ubl4a

DIOPT Version :10

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_663380.1 Gene:Ubl4a / 27643 MGIID:95049 Length:157 Species:Mus musculus


Alignment Length:155 Identity:48/155 - (30%)
Similarity:72/155 - (46%) Gaps:21/155 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 MQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 217
            ||:.||.|.|:..:|:|...:.:..:|..:.||..:|..||||:|.||.|.|.:.||||||...|
Mouse     1 MQLTVKALQGRECSLQVAEDELVSTLKHLVSDKLNVPVRQQRLLFKGKALADEKRLSDYNIGPNS 65

  Fly   218 TLHLVLRLRGGMQIFVKTL------TGKTITLEVEPSDTIKHVKARIHDKDGIPPDHQRLIFAGK 276
            .|:||          ||.|      .|....|...|:..|..:.:::..:.....|..|::   :
Mouse    66 KLNLV----------VKPLEKVLLEEGSAHRLVDSPATPIWQLISKVLARHFSVADASRVL---E 117

  Fly   277 QLED--GRTLSDYNIQKESTLHSHF 299
            ||:.  .|:||...:.....|.|.|
Mouse   118 QLQRDYDRSLSRLTLDDIERLASRF 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130
Ubl1_cv_Nsp3_N-like 77..152 CDD:475130
Ubl_ubiquitin 153..228 CDD:340501 31/74 (42%)
Ubl1_cv_Nsp3_N-like 229..296 CDD:475130 14/74 (19%)
Ubl4aNP_663380.1 Ubl_UBL4A_like 1..72 CDD:340505 31/80 (39%)
Tugs 96..142 CDD:465528 9/48 (19%)
Required and sufficient for interaction with BAG6. /evidence=ECO:0000250|UniProtKB:P11441 96..138 7/44 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.