DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and ubi3

DIOPT Version :10

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_594108.1 Gene:ubi3 / 2541445 PomBaseID:SPAC6G10.11C Length:150 Species:Schizosaccharomyces pombe


Alignment Length:106 Identity:77/106 - (72%)
Similarity:84/106 - (79%) Gaps:8/106 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 MQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 217
            ||||||||||||||||||.||:|:|||::|.||||||||||||||||||||||||||||||||||
pombe     1 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 65

  Fly   218 TLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIKHVKARI 258
            |||||||||||    .|....||.|...:    |||...::
pombe    66 TLHLVLRLRGG----GKKRKKKTYTTPKK----IKHKHKKV 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130
Ubl1_cv_Nsp3_N-like 77..152 CDD:475130
Ubl_ubiquitin 153..228 CDD:340501 68/74 (92%)
Ubl1_cv_Nsp3_N-like 229..296 CDD:475130 7/30 (23%)
ubi3NP_594108.1 Ubl_ubiquitin 1..76 CDD:340501 68/74 (92%)
Ribosomal_S27 103..145 CDD:460261
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.