DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and rhp23

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_596231.1 Gene:rhp23 / 2540481 PomBaseID:SPBC2D10.12 Length:368 Species:Schizosaccharomyces pombe


Alignment Length:238 Identity:48/238 - (20%)
Similarity:90/238 - (37%) Gaps:48/238 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 MQIFVKTLTGKTITLEVEPSDT-IENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKE 140
            |.:..|.|..:...:....:|| |..:|.|||.::....|.|:||:.|:.|.:.:|:.:|||:: 
pombe     1 MNLTFKNLQQQKFVISDVSADTKISELKEKIQTQQNYEVERQKLIYSGRILADDKTVGEYNIKE- 64

  Fly   141 STIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIE---NVKARIHDKEGIPPDQ---------Q 193
                         |.|:..:..:..|....|..:..   |..|.:.:|:...|..         |
pombe    65 -------------QDFIVCMVSRPKTSTSTPKSAASPAPNPPASVPEKKVEAPSSTVAESTSTTQ 116

  Fly   194 RLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIKHVKARI 258
            .:..|.....|....|:..|...:     |.:.....:.|:.:    :.:..|.|:..:.::|..
pombe   117 TVAAAAPSNPDTTATSEAPIDANT-----LAVGAQRNVAVENM----VEMGYERSEVERAMRAAF 172

  Fly   259 HDKD--------GIPPDHQRLIFAGKQLEDGRTLSDYNIQKES 293
            ::.|        |||.|    |...::.|....|:....|.|:
pombe   173 NNPDRAVEYLLTGIPED----ILNRQREESAAALAAQQQQSEA 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398 20/75 (27%)
UBQ 77..148 CDD:214563 20/71 (28%)
Ubiquitin 153..228 CDD:176398 14/86 (16%)
UBQ 153..224 CDD:214563 13/82 (16%)
UBQ 229..296 CDD:214563 14/73 (19%)
UBQ 229..296 CDD:294102 14/73 (19%)
rhp23NP_596231.1 rad23 1..363 CDD:273167 48/238 (20%)
RAD23_N 1..76 CDD:176400 22/88 (25%)
UBA1_Rhp23p_like 141..187 CDD:270561 7/49 (14%)
XPC-binding 247..302 CDD:286376
UBA2_Rhp23p_like 321..360 CDD:270564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.