DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and Oas1b

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_653353.2 Gene:Oas1b / 246268 RGDID:708393 Length:379 Species:Rattus norvegicus


Alignment Length:223 Identity:41/223 - (18%)
Similarity:72/223 - (32%) Gaps:61/223 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 KEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIYL--------VLRLRGGMQIFVKTLTGKTI 165
            :|.:.|.....:..|.....|.||..:: ..:..::|        .|..||.   |.|.:  |.:
  Rat    47 RESSHPVRTSKVGKGGSSRKGTTLKGWS-DADLVVFLDSFTCFGDQLNRRGE---FTKEI--KKL 105

  Fly   166 TLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTL----------H 220
            ..||:....| .||..:|....  |:.:.|.|         .||..:.|||...          |
  Rat   106 LFEVQRDRHI-GVKIEVHSSWS--PNHRALSF---------KLSAPDQQKEVKFDVLPAYDLLGH 158

  Fly   221 LVLRLRGGMQIFVKTLTGKTITLEVEPSDT-----------------------IKHVKARIHDK- 261
            :.:..:...|.:...::.:|...:.:...|                       :||......:| 
  Rat   159 VCIPRKPNPQFYANLISERTSLGKEDEFSTCFTELQLYFLNWRPTKLKSLIRLVKHWYQLCKEKL 223

  Fly   262 -DGIPPDHQRLIFAGKQLEDGRTLSDYN 288
             |.:||.:...:......|.|..|:.:|
  Rat   224 GDPLPPQYALELLTIYAWERGGRLTKFN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398 9/50 (18%)
UBQ 77..148 CDD:214563 7/46 (15%)
Ubiquitin 153..228 CDD:176398 18/84 (21%)
UBQ 153..224 CDD:214563 18/80 (23%)
UBQ 229..296 CDD:214563 13/85 (15%)
UBQ 229..296 CDD:294102 13/85 (15%)
Oas1bNP_653353.2 NT_2-5OAS_ClassI-CCAase 27..176 CDD:143390 29/146 (20%)
OAS1_C 164..347 CDD:287404 13/88 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.