DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and Ubqlnl

DIOPT Version :10

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_941026.2 Gene:Ubqlnl / 244179 MGIID:2685336 Length:610 Species:Mus musculus


Alignment Length:78 Identity:21/78 - (26%)
Similarity:35/78 - (44%) Gaps:1/78 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 GGMQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 215
            |.:::.||| .|..|...|.....:...|..:........:|..|:|.|:.|:|..|||...|..
Mouse    29 GVIRVIVKT-PGNQIIFTVADDTLVRQFKEILSAHFKCQMEQLVLVFMGRLLKDHDTLSQRGITD 92

  Fly   216 ESTLHLVLRLRGG 228
            ...:|:|::.:.|
Mouse    93 GHIIHVVIKSKHG 105

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130