DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and Ubd

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_075626.1 Gene:Ubd / 24108 MGIID:1344410 Length:162 Species:Mus musculus


Alignment Length:148 Identity:45/148 - (30%)
Similarity:74/148 - (50%) Gaps:6/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIYLVLRL-- 149
            :.:|.|...:|.::.:...|:.:.:...:.|.|:...|.|:..|.||.|.|.||:||:|.|::  
Mouse    15 RLMTFETTENDKVKKINEHIRSQTKVSVQDQILLLDSKILKPHRKLSSYGIDKETTIHLTLKVVK 79

  Fly   150 --RGGMQIFV--KTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSD 210
              ...:.:|:  ....|:...|.|..|.|:..||..|.....:.|.:|.:...||:||||:.::|
Mouse    80 PSDEELPLFLVESKNEGQRHLLRVRRSSSVAQVKEMIESVTSVIPKKQVVNCNGKKLEDGKIMAD 144

  Fly   211 YNIQKESTLHLVLRLRGG 228
            |||:..|.|.|.....||
Mouse   145 YNIKSGSLLFLTTHCTGG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398 19/68 (28%)
UBQ 77..148 CDD:214563 18/60 (30%)
Ubiquitin 153..228 CDD:176398 24/76 (32%)
UBQ 153..224 CDD:214563 24/72 (33%)
UBQ 229..296 CDD:214563 45/148 (30%)
UBQ 229..296 CDD:294102 45/148 (30%)
UbdNP_075626.1 UBQ 9..76 CDD:214563 18/60 (30%)
UBQ 15..76 CDD:294102 18/60 (30%)
UBQ 96..155 CDD:214563 22/58 (38%)
UBQ 96..155 CDD:294102 22/58 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54325
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.