DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and FAU

DIOPT Version :10

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001988.1 Gene:FAU / 2197 HGNCID:3597 Length:133 Species:Homo sapiens


Alignment Length:76 Identity:26/76 - (34%)
Similarity:42/76 - (55%) Gaps:2/76 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 MQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 217
            ||:||:  ..:..|.||...:::..:||.:...|||.|:.|.::.||..|||..||....::..:
Human     1 MQLFVR--AQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALT 63

  Fly   218 TLHLVLRLRGG 228
            ||.:..|:.||
Human    64 TLEVAGRMLGG 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130
Ubl1_cv_Nsp3_N-like 77..152 CDD:475130
Ubl_ubiquitin 153..228 CDD:340501 24/74 (32%)
Ubl1_cv_Nsp3_N-like 229..296 CDD:475130 26/76 (34%)
FAUNP_001988.1 Ubl_FUBI 1..74 CDD:340491 24/74 (32%)
Ribosomal_S30 75..132 CDD:398432 26/76 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..110
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.