DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11700 and F52C6.4

DIOPT Version :9

Sequence 1:	NP_572306.1	Gene:	CG11700 / 31564	FlyBaseID:	FBgn0029856	Length:	301	Species:	Drosophila melanogaster
Sequence 2:	NP_001379809.1	Gene:	F52C6.4 / 186086	WormBaseID:	WBGene00018661	Length:	100	Species:	Caenorhabditis elegans

Alignment Length:	182	Identity:	50/182 - (27%)
Similarity:	72/182 - (39%)	Gaps:	82/182 - (45%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKES 65
            |.:.|||.||||||:|..     :|||.:::||       |.::|...:.|
Worm     1 MLLSVKTSTGKTITVEAP-----KNVKTEVRDK-------QGVVFTVSYGE-------------- 39

  Fly    66 TIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGR 130
                              :||..||  ||.||.|:::..|:.:.:..|           |
Worm    40 ------------------VTGDPIT--VEASDAIKDLNFKVAEAQRKP-----------H----- 68

  Fly   131 TLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIENVKARI 182
                               |.||:|:|||.. |||||:...||:|.:|||:|
Worm    69 -------------------REGMRIYVKTCE-KTITLDTAASDTIASVKAKI 100

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11700	NP_572306.1	Ubiquitin	1..76	CDD:176398	19/74 (26%)
		UBQ	1..72	CDD:214563	19/70 (27%)
		Ubiquitin	77..152	CDD:176398	13/74 (18%)
		UBQ	77..148	CDD:214563	12/70 (17%)
		Ubiquitin	153..228	CDD:176398	17/30 (57%)
		UBQ	153..224	CDD:214563	17/30 (57%)
		UBQ	229..296	CDD:214563
		UBQ	229..296	CDD:294102
F52C6.4	NP_001379809.1	Ubiquitin_like_fold	1..>31	CDD:421700	17/41 (41%)
F52C6.4	NP_001379809.1	Ubiquitin_like_fold	72..>100	CDD:421700	16/28 (57%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900