powered by:
Protein Alignment CG11700 and F34H10.1
DIOPT Version :9
Sequence 1: | NP_572306.1 |
Gene: | CG11700 / 31564 |
FlyBaseID: | FBgn0029856 |
Length: | 301 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001359527.1 |
Gene: | F34H10.1 / 185243 |
WormBaseID: | WBGene00009378 |
Length: | 63 |
Species: | Caenorhabditis elegans |
Alignment Length: | 48 |
Identity: | 11/48 - (22%) |
Similarity: | 20/48 - (41%) |
Gaps: | 5/48 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 74 RGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIF 121
|..:|:||:.:.... ..|..::.:.:..:|......|.|||.|
Worm 17 RKKLQMFVRLMPKNQ-----RKSSIVQKLISPFKDGFTCKEEKQRLCF 59
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160156799 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.830 |
|
Return to query results.
Submit another query.