DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and C16C8.4

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_494542.1 Gene:C16C8.4 / 182671 WormBaseID:WBGene00015842 Length:226 Species:Caenorhabditis elegans


Alignment Length:238 Identity:63/238 - (26%)
Similarity:94/238 - (39%) Gaps:70/238 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTIYLVLRLRGGMQI 79
            |..|||..:||         :...|.|.|.  |:.|:|         |:|..| |..:||...:|
 Worm    29 LPSEPSSFVEN---------QLLLETQTLC--GQLLKN---------QEEQNI-LNEKLRNEQKI 72

  Fly    80 F-------VKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNI 137
            .       :|::..|.        :|:...:|.           |:|.| .:|.|..|......|
 Worm    73 IKLKHNTEMKSMRDKL--------ETLTTAQAA-----------QKLDF-ERHFEMMRQSHSAKI 117

  Fly   138 QK-----ESTIYLVLRLRGGM----------------QIFVKTLTGKTITLEVEPSDSIENVKAR 181
            .|     .:..|.:..||..|                |||||.| |.:...::...|::.::|..
 Worm   118 VKMERDLRNMKYDLHSLRSDMDSRKNCENRAAPKPEFQIFVKVL-GVSYAFKIHREDTVFDIKND 181

  Fly   182 IHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR 224
            |..:..||.....|.|:||:|||..::.||||||.||:.:..|
 Worm   182 IEHRHDIPQHSYWLSFSGKRLEDHCSIGDYNIQKSSTITMYFR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 18/60 (30%)
UBQ 1..72 CDD:214563 16/56 (29%)
Ubiquitin 77..152 CDD:176398 16/86 (19%)
UBQ 77..148 CDD:214563 14/82 (17%)
Ubiquitin 153..228 CDD:176398 29/88 (33%)
UBQ 153..224 CDD:214563 28/86 (33%)
UBQ 229..296 CDD:214563
UBQ 229..296 CDD:294102
C16C8.4NP_494542.1 UBQ 154..224 CDD:214563 27/70 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.