DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11700 and ubq-2

DIOPT Version :9

Sequence 1:	NP_572306.1	Gene:	CG11700 / 31564	FlyBaseID:	FBgn0029856	Length:	301	Species:	Drosophila melanogaster
Sequence 2:	NP_499695.1	Gene:	ubq-2 / 176718	WormBaseID:	WBGene00006728	Length:	128	Species:	Caenorhabditis elegans

Alignment Length:	96	Identity:	75/96 - (78%)
Similarity:	79/96 - (82%)	Gaps:	15/96 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   153 MQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 217
            ||||||||||||||||||.||:||||||:|.||||||||||||||||||||||||||||||||||
Worm     1 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 65

  Fly   218 TLHLVLRLRGGMQIFVKTLTGKTITLEVEPS 248
            |||||||||||:               :|||
Worm    66 TLHLVLRLRGGI---------------IEPS 81

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11700	NP_572306.1	Ubiquitin	1..76	CDD:176398
		UBQ	1..72	CDD:214563
		Ubiquitin	77..152	CDD:176398
		UBQ	77..148	CDD:214563
		Ubiquitin	153..228	CDD:176398	70/74 (95%)
		UBQ	153..224	CDD:214563	66/70 (94%)
		UBQ	229..296	CDD:214563	3/20 (15%)
		UBQ	229..296	CDD:294102	3/20 (15%)
ubq-2	NP_499695.1	Ubiquitin	1..76	CDD:176398	70/74 (95%)
		UBQ	1..72	CDD:214563	66/70 (94%)
		Ribosomal_L40e	78..126	CDD:279372	3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D642374at33208
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.920