DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and ubq-1

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_741157.1 Gene:ubq-1 / 175840 WormBaseID:WBGene00006727 Length:838 Species:Caenorhabditis elegans


Alignment Length:296 Identity:265/296 - (89%)
Similarity:279/296 - (94%) Gaps:0/296 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKES 65
            ||||||||||||||||||.|||||||||||||||..||:.|||||.||.||:|||||||||||||
 Worm     1 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 65

  Fly    66 TIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGR 130
            |::||||||||||||||||||||||||||.|||||||||||||||..||:.|||||.||.||:||
 Worm    66 TLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGR 130

  Fly   131 TLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRL 195
            ||||||||||||::||||||||||||||||||||||||||.||:||||||:|.||||||||||||
 Worm   131 TLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRL 195

  Fly   196 IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIKHVKARIHD 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||.||||::|||:|.|
 Worm   196 IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQD 260

  Fly   261 KDGIPPDHQRLIFAGKQLEDGRTLSDYNIQKESTLH 296
            |:|||||.||||||||||||||||||||||||||||
 Worm   261 KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 64/74 (86%)
UBQ 1..72 CDD:214563 60/70 (86%)
Ubiquitin 77..152 CDD:176398 64/74 (86%)
UBQ 77..148 CDD:214563 60/70 (86%)
Ubiquitin 153..228 CDD:176398 70/74 (95%)
UBQ 153..224 CDD:214563 66/70 (94%)
UBQ 229..296 CDD:214563 59/66 (89%)
UBQ 229..296 CDD:294102 59/66 (89%)
ubq-1NP_741157.1 Ubiquitin 1..76 CDD:176398 64/74 (86%)
UBQ 1..72 CDD:214563 60/70 (86%)
Ubiquitin 77..152 CDD:176398 64/74 (86%)
UBQ 77..148 CDD:214563 60/70 (86%)
Ubiquitin 153..228 CDD:176398 70/74 (95%)
UBQ 153..224 CDD:214563 66/70 (94%)
Ubiquitin 229..304 CDD:176398 61/68 (90%)
UBQ 229..300 CDD:214563 61/68 (90%)
Ubiquitin 305..380 CDD:176398
UBQ 305..376 CDD:214563
Ubiquitin 381..456 CDD:176398
UBQ 381..452 CDD:214563
Ubiquitin 457..532 CDD:176398
UBQ 457..528 CDD:214563
Ubiquitin 533..608 CDD:176398
UBQ 533..604 CDD:214563
Ubiquitin 609..684 CDD:176398
UBQ 609..680 CDD:214563
Ubiquitin 685..760 CDD:176398
UBQ 685..756 CDD:214563
Ubiquitin 761..836 CDD:176398
UBQ 761..832 CDD:214563
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D642374at33208
OrthoFinder 1 1.000 - - FOG0000540
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.