DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and ubl-1

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_741102.1 Gene:ubl-1 / 175413 WormBaseID:WBGene00006725 Length:163 Species:Caenorhabditis elegans


Alignment Length:74 Identity:33/74 - (44%)
Similarity:50/74 - (67%) Gaps:5/74 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 IFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTL 219
            :||||| .:|:.|||..::.:.::|.:|...||||.::|||.:||:||||    ||..|..|:|:
 Worm     2 VFVKTL-HRTLFLEVAANEDVLSIKQKIEAAEGIPAEEQRLCYAGRQLED----SDCGIDSEATI 61

  Fly   220 HLVLRLRGG 228
            ::.|.|.||
 Worm    62 YVNLELLGG 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398
UBQ 77..148 CDD:214563
Ubiquitin 153..228 CDD:176398 31/72 (43%)
UBQ 153..224 CDD:214563 29/68 (43%)
UBQ 229..296 CDD:214563 33/74 (45%)
UBQ 229..296 CDD:294102 33/74 (45%)
ubl-1NP_741102.1 UBQ 1..66 CDD:214563 29/68 (43%)
UBQ 2..70 CDD:294102 31/72 (43%)
Ribosomal_S27 97..141 CDD:279879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156798
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D642374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.