DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and F52C6.2

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_494128.3 Gene:F52C6.2 / 173558 WormBaseID:WBGene00018659 Length:228 Species:Caenorhabditis elegans


Alignment Length:255 Identity:76/255 - (29%)
Similarity:123/255 - (48%) Gaps:64/255 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIF--------GGKHLENGRTLS 57
            |.:.:||.||||||:|...|     ||.:::.|       |.::|        |.:.:|...|:.
 Worm     1 MLLSIKTSTGKTITVEAPKS-----VKTEVRYK-------QGVVFAVSYDKDAGNQIIEMEDTVQ 53

  Fly    58 DYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENP----PEHQR 118
            |..||:...    ..||...::     ||..|  :||.|||..|        ||||    |..:.
 Worm    54 DVKIQEAQQ----APLRESEEV-----TGDPI--KVEASDTNRN--------EENPDLAGPPAEP 99

  Fly   119 LIFG-------------GKHL-ENGRTLSDY----NIQKESTIYLVLRLR--GGMQIFVKTLT-G 162
            :|.|             ||.: :..|..:.|    .:::.::.|.:.|:.  |...:|||..| |
 Worm   100 VIRGTAASGRIVNVRLAGKRIVQPNRRFTSYLPSSAVRRVASPYQIRRVSVDGNFNVFVKNSTGG 164

  Fly   163 KTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222
            ||..:.::.:|:|..:|.::.:||||||:||||:|.|.:|.|.||::...:::.::|.||
 Worm   165 KTTAVSIKNTDTIGTLKLKVQEKEGIPPNQQRLLFKGSELMDYRTVAHCGLRQGTSLDLV 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 24/82 (29%)
UBQ 1..72 CDD:214563 22/78 (28%)
Ubiquitin 77..152 CDD:176398 22/98 (22%)
UBQ 77..148 CDD:214563 21/92 (23%)
Ubiquitin 153..228 CDD:176398 29/71 (41%)
UBQ 153..224 CDD:214563 29/71 (41%)
UBQ 229..296 CDD:214563
UBQ 229..296 CDD:294102
F52C6.2NP_494128.3 ubiquitin 157..224 CDD:365970 27/66 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I3863
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.