DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and UBL4B

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_981957.1 Gene:UBL4B / 164153 HGNCID:32309 Length:174 Species:Homo sapiens


Alignment Length:209 Identity:51/209 - (24%)
Similarity:88/209 - (42%) Gaps:52/209 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKES 65
            |.:.||.|.|:..:|:|...:::..:|..:..:.:.|.|.|.|:|.|:.||:.:.||||.|...:
Human     1 MFLTVKLLLGQRCSLKVSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYCIGPNA 65

  Fly    66 TIYLVLR------LRGGMQIFVKTL---TGKTITLEVEPSDTIENVKAKIQ-DKEENPPEHQRLI 120
            :|.::::      |:...|...:.|   .|..:....||.|    .||.:| .::|:....|::.
Human    66 SINVIMQPLEKMALKEAHQPQTQPLWHQLGLVLAKHFEPQD----AKAVLQLLRQEHEERLQKIS 126

  Fly   121 FGGKHLENGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIE-NVKAR--- 181
            .  :|||.   |:.|.:.:|.                          .|||:...| ..|||   
Human   127 L--EHLEQ---LAQYLLAEEP--------------------------HVEPAGERELEAKARPQS 160

  Fly   182 ---IHDKEGIPPDQ 192
               :.:||....||
Human   161 SCDMEEKEEAAADQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 23/80 (29%)
UBQ 1..72 CDD:214563 22/70 (31%)
Ubiquitin 77..152 CDD:176398 17/78 (22%)
UBQ 77..148 CDD:214563 17/74 (23%)
Ubiquitin 153..228 CDD:176398 11/47 (23%)
UBQ 153..224 CDD:214563 11/47 (23%)
UBQ 229..296 CDD:214563
UBQ 229..296 CDD:294102
UBL4BNP_981957.1 UBQ 1..74 CDD:320785 22/72 (31%)
FlhF 20..>154 CDD:332151 37/168 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..174 10/58 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.