Sequence 1: | NP_572306.1 | Gene: | CG11700 / 31564 | FlyBaseID: | FBgn0029856 | Length: | 301 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_981957.1 | Gene: | UBL4B / 164153 | HGNCID: | 32309 | Length: | 174 | Species: | Homo sapiens |
Alignment Length: | 209 | Identity: | 51/209 - (24%) |
---|---|---|---|
Similarity: | 88/209 - (42%) | Gaps: | 52/209 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKES 65
Fly 66 TIYLVLR------LRGGMQIFVKTL---TGKTITLEVEPSDTIENVKAKIQ-DKEENPPEHQRLI 120
Fly 121 FGGKHLENGRTLSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIE-NVKAR--- 181
Fly 182 ---IHDKEGIPPDQ 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11700 | NP_572306.1 | Ubiquitin | 1..76 | CDD:176398 | 23/80 (29%) |
UBQ | 1..72 | CDD:214563 | 22/70 (31%) | ||
Ubiquitin | 77..152 | CDD:176398 | 17/78 (22%) | ||
UBQ | 77..148 | CDD:214563 | 17/74 (23%) | ||
Ubiquitin | 153..228 | CDD:176398 | 11/47 (23%) | ||
UBQ | 153..224 | CDD:214563 | 11/47 (23%) | ||
UBQ | 229..296 | CDD:214563 | |||
UBQ | 229..296 | CDD:294102 | |||
UBL4B | NP_981957.1 | UBQ | 1..74 | CDD:320785 | 22/72 (31%) |
FlhF | 20..>154 | CDD:332151 | 37/168 (22%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 141..174 | 10/58 (17%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5272 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |