DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11700 and UBQLNL

DIOPT Version :9

Sequence 1:	NP_572306.1	Gene:	CG11700 / 31564	FlyBaseID:	FBgn0029856	Length:	301	Species:	Drosophila melanogaster
Sequence 2:	NP_659490.4	Gene:	UBQLNL / 143630	HGNCID:	28294	Length:	475	Species:	Homo sapiens

Alignment Length:	133	Identity:	31/133 - (23%)
Similarity:	49/133 - (36%)	Gaps:	12/133 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   132 LSDYNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLI 196
            |:|.||...:|           ::.||| .|......|....|:...|..:........||..|:
Human    21 LADKNISSSAT-----------RVIVKT-AGNQKDFMVADDISVRQFKEMLLAHFQCQMDQLVLV 73

  Fly   197 FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIKHVKARIHDK 261
            |.|..|:|..|||...|....|::||::.:.|.:....:................|...:|:|..
Human    74 FMGCLLKDHDTLSQRGIMDGHTIYLVIKSKQGSRSLAHSFRDLPTNDPCHRDRNTKGNSSRVHQP 138

  Fly   262 DGI 264
            .|:
Human   139 TGM 141

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11700	NP_572306.1	Ubiquitin	1..76	CDD:176398
		UBQ	1..72	CDD:214563
		Ubiquitin	77..152	CDD:176398	5/19 (26%)
		UBQ	77..148	CDD:214563	5/15 (33%)
		Ubiquitin	153..228	CDD:176398	21/74 (28%)
		UBQ	153..224	CDD:214563	21/70 (30%)
		UBQ	229..296	CDD:214563	4/36 (11%)
		UBQ	229..296	CDD:294102	4/36 (11%)
UBQLNL	NP_659490.4	UBQ	32..101	CDD:214563	21/69 (30%)
		UBQ	32..101	CDD:294102	21/69 (30%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	113..138		3/24 (13%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	305..325
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900