DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and LOC1273574

DIOPT Version :10

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_312567.4 Gene:LOC1273574 / 1273574 VectorBaseID:AGAMI1_013616 Length:139 Species:Anopheles gambiae


Alignment Length:120 Identity:33/120 - (27%)
Similarity:56/120 - (46%) Gaps:23/120 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKES 141
            |::.:|.|.|:..::|.....||:.:|.:|:.|...|.|||:|:..||.|.:.:|::.|.     
Mosquito     1 MKLTIKILKGEEYSVETTEEATIQQIKEEIEKKSSIPVEHQKLLLVGKALADEKTVASYG----- 60

  Fly   142 TIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQ-QRL 195
                            ..:.|..:||.|:..|.:.:|..| |.|..:..:| |||
Mosquito    61 ----------------SIVDGTKLTLVVKKPDPLRDVIYR-HFKRYLQEEQSQRL 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130
Ubl1_cv_Nsp3_N-like 77..152 CDD:475130 20/74 (27%)
Ubl_ubiquitin 153..228 CDD:340501 13/44 (30%)
Ubl1_cv_Nsp3_N-like 229..296 CDD:475130
LOC1273574XP_312567.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.