DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and AgaP_AGAP000733

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_311268.5 Gene:AgaP_AGAP000733 / 1272322 VectorBaseID:AGAP000733 Length:390 Species:Anopheles gambiae


Alignment Length:64 Identity:26/64 - (40%)
Similarity:41/64 - (64%) Gaps:3/64 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 MQIFVKTLTGKTITLEVE-PSDTIKHVKARIHDKDGI--PPDHQRLIFAGKQLEDGRTLSDYNI 289
            |:|.:|||..:|..:||: ..||::.:|.::|.:.|:  |.|.||||:.||.:||...||.|.:
Mosquito     1 MKITLKTLKQQTFFVEVDVEQDTVRTLKEKLHAESGLAYPVDRQRLIYLGKIMEDDHLLSQYKL 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398
UBQ 77..148 CDD:214563
Ubiquitin 153..228 CDD:176398
UBQ 153..224 CDD:214563
UBQ 229..296 CDD:214563 26/64 (41%)
UBQ 229..296 CDD:294102 26/64 (41%)
AgaP_AGAP000733XP_311268.5 rad23 1..387 CDD:273167 26/64 (41%)
RAD23_N 1..78 CDD:176400 26/64 (41%)
UBA1_NUB1_like 180..212 CDD:270477
XPC-binding 260..315 CDD:286376
UBA_like_SF 346..384 CDD:304366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.