powered by:
Protein Alignment CG11700 and AgaP_AGAP000733
DIOPT Version :9
Sequence 1: | NP_572306.1 |
Gene: | CG11700 / 31564 |
FlyBaseID: | FBgn0029856 |
Length: | 301 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_311268.5 |
Gene: | AgaP_AGAP000733 / 1272322 |
VectorBaseID: | AGAP000733 |
Length: | 390 |
Species: | Anopheles gambiae |
Alignment Length: | 64 |
Identity: | 26/64 - (40%) |
Similarity: | 41/64 - (64%) |
Gaps: | 3/64 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 229 MQIFVKTLTGKTITLEVE-PSDTIKHVKARIHDKDGI--PPDHQRLIFAGKQLEDGRTLSDYNI 289
|:|.:|||..:|..:||: ..||::.:|.::|.:.|: |.|.||||:.||.:||...||.|.:
Mosquito 1 MKITLKTLKQQTFFVEVDVEQDTVRTLKEKLHAESGLAYPVDRQRLIYLGKIMEDDHLLSQYKL 64
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.