DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and Oas1c

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_291019.1 Gene:Oas1c / 114643 MGIID:2149633 Length:362 Species:Mus musculus


Alignment Length:184 Identity:43/184 - (23%)
Similarity:70/184 - (38%) Gaps:56/184 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IENVKAKIQDK----EENPPEHQRLIFGGKHLEN----GRT----------LSDYNIQKESTIYL 69
            |:::.|.::::    ..:|....|::.||.:.|:    |::          |:.:..|       
Mouse    35 IDSISAFLKERCFQGAAHPVRVSRVVMGGSYDEHTALKGKSEAKMVLFFNNLTSFEEQ------- 92

  Fly    70 VLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSD 134
             |:.||.   ||:.:......|:.|..   ..||.::|..||  |..:.|.|         .||.
Mouse    93 -LKRRGE---FVEEIQKHLCQLQQEKP---FKVKFEVQSSEE--PNSRSLSF---------KLSS 139

  Fly   135 YNIQKE-----STIYLVL-RLRGGM----QIFVKT---LTGKTITLEVEPSDSI 175
            ..:|:|     ...|.|| .||...    |.:.|.   |..:..|||.|...||
Mouse   140 PELQQEVEFDVQPAYDVL
YELRNNTYAEPQFYNKVYAQLIHECTTLEKEGDFSI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398 12/70 (17%)
UBQ 1..72 CDD:214563 10/66 (15%)
Ubiquitin 77..152 CDD:176398 21/80 (26%)
UBQ 77..148 CDD:214563 19/76 (25%)
Ubiquitin 153..228 CDD:176398 9/30 (30%)
UBQ 153..224 CDD:214563 9/30 (30%)
UBQ 229..296 CDD:214563
UBQ 229..296 CDD:294102
Oas1cNP_291019.1 NT_2-5OAS_ClassI-CCAase 27..>157 CDD:143390 30/146 (21%)
OAS1_C 173..355 CDD:313619 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.