DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and UBD

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_006389.2 Gene:UBD / 10537 HGNCID:18795 Length:165 Species:Homo sapiens


Alignment Length:156 Identity:52/156 - (33%)
Similarity:84/156 - (53%) Gaps:6/156 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYNIQKESTI 143
            :.|::.....:|.:..|.|:::.:|..::.|.:.|.:.|.|:.|.|.|:..|:||.|.|.||.||
Human    10 VHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTI 74

  Fly   144 YLVLRL----RGGMQIFVKTL--TGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQL 202
            :|.|::    ...:.:|:...  ..|...|:|..|.|:..|||.|..|.||.|:.|.:...||:|
Human    75 HLTLK
VVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRL 139

  Fly   203 EDGRTLSDYNIQKESTLHLVLRLRGG 228
            |||:.::||.|:|.:.|.|.....||
Human   140 EDGKMMADYGIRKGNLLFLACYCIGG 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398 23/76 (30%)
UBQ 77..148 CDD:214563 22/68 (32%)
Ubiquitin 153..228 CDD:176398 27/76 (36%)
UBQ 153..224 CDD:214563 27/72 (38%)
UBQ 229..296 CDD:214563 52/156 (33%)
UBQ 229..296 CDD:294102 52/156 (33%)
UBDNP_006389.2 UBQ 8..79 CDD:214563 22/68 (32%)
UBQ 104..165 CDD:320785 25/60 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54325
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.