DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11700 and NEDD8-MDP1

DIOPT Version :9

Sequence 1:	NP_572306.1	Gene:	CG11700 / 31564	FlyBaseID:	FBgn0029856	Length:	301	Species:	Drosophila melanogaster
Sequence 2:	NP_001186752.1	Gene:	NEDD8-MDP1 / 100528064	HGNCID:	39551	Length:	193	Species:	Homo sapiens

Alignment Length:	142	Identity:	51/142 - (35%)
Similarity:	72/142 - (50%)	Gaps:	26/142 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   153 MQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDG----RTLSDYNI 213
            |.|.|||||||.|.:::||:|.:|.:|.|:.:||||||.|||||::|||: ||    |...|..:
Human     1 MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQI-DGTVRDRRGQDVRL 64

  Fly   214 QKESTLHLVLRLR-----GGMQIFVKTLTGKTITL------------EVEPSDTIKHVKARIHDK 261
            ..| ...::.||:     |........:.|....|            |:.|...|.|.: |:..|
Human    65 YPE-VPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFE-RLQQK 127

  Fly   262 DGIPPDHQRLIF 273
            .|||  ..::||
Human   128 TGIP--FSQMIF 137

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11700	NP_572306.1	Ubiquitin	1..76	CDD:176398
		UBQ	1..72	CDD:214563
		Ubiquitin	77..152	CDD:176398
		UBQ	77..148	CDD:214563
		Ubiquitin	153..228	CDD:176398	37/83 (45%)
		UBQ	153..224	CDD:214563	35/74 (47%)
		UBQ	229..296	CDD:214563	13/57 (23%)
		UBQ	229..296	CDD:294102	13/57 (23%)
NEDD8-MDP1	NP_001186752.1	UBQ	1..>51	CDD:294102	30/50 (60%)
		UBQ	1..>50	CDD:214563	29/48 (60%)
		Acid_PPase	51..177	CDD:289459	21/91 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900