DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11700 and LOC100363494

DIOPT Version :9

Sequence 1:NP_572306.1 Gene:CG11700 / 31564 FlyBaseID:FBgn0029856 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_002728156.1 Gene:LOC100363494 / 100363494 RGDID:2322951 Length:77 Species:Rattus norvegicus


Alignment Length:76 Identity:69/76 - (90%)
Similarity:73/76 - (96%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 MQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 217
            |||||||||||||||||||||:||||||:|.|||.||||||||||||||||||||||||:||:||
  Rat     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKESIPPDQQRLIFAGKQLEDGRTLSDYSIQEES 65

  Fly   218 TLHLVLRLRGG 228
            ||||||.||||
  Rat    66 TLHLVLPLRGG 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11700NP_572306.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398
UBQ 77..148 CDD:214563
Ubiquitin 153..228 CDD:176398 67/74 (91%)
UBQ 153..224 CDD:214563 64/70 (91%)
UBQ 229..296 CDD:214563 69/76 (91%)
UBQ 229..296 CDD:294102 69/76 (91%)
LOC100363494XP_002728156.1 Ubiquitin 1..76 CDD:176398 67/74 (91%)
UBQ 1..71 CDD:214563 63/69 (91%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D642374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.