DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11700 and zfand4

DIOPT Version :9

Sequence 1:	NP_572306.1	Gene:	CG11700 / 31564	FlyBaseID:	FBgn0029856	Length:	301	Species:	Drosophila melanogaster
Sequence 2:	NP_001189400.1	Gene:	zfand4 / 100148477	ZFINID:	ZDB-GENE-090312-102	Length:	673	Species:	Danio rerio

Alignment Length:	94	Identity:	39/94 - (41%)
Similarity:	55/94 - (58%)	Gaps:	0/94 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   135 YNIQKESTIYLVLRLRGGMQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAG 199
            :|......::..|.....|::|::||||....|.|.|.:.:.:|||:|...||||..||.||:.|
Zfish    10 FNDDNVGVLHYKLPFSETMELFIETLTGTCFQLRVSPFEQVVSVKAKIQRLEGIPVSQQHLIWNG 74

  Fly   200 KQLEDGRTLSDYNIQKESTLHLVLRLRGG 228
            .:|||...|.||:|.:..||.|||.:|||
Zfish    75 MELEDEYCLHDYSITEGCTLKLVLAMRGG 103

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11700	NP_572306.1	Ubiquitin	1..76	CDD:176398
		UBQ	1..72	CDD:214563
		Ubiquitin	77..152	CDD:176398	2/16 (13%)
		UBQ	77..148	CDD:214563	1/12 (8%)
		Ubiquitin	153..228	CDD:176398	35/74 (47%)
		UBQ	153..224	CDD:214563	33/70 (47%)
		UBQ	229..296	CDD:214563	39/94 (41%)
		UBQ	229..296	CDD:294102	39/94 (41%)
zfand4	NP_001189400.1	AN1_N	1..103	CDD:176397	37/92 (40%)
		UBQ	28..99	CDD:214563	33/70 (47%)
		ZnF_AN1	613..651	CDD:197545
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900