DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and CYB5

DIOPT Version :9

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_014288.3 Gene:CYB5 / 855612 SGDID:S000005055 Length:120 Species:Saccharomyces cerevisiae


Alignment Length:77 Identity:39/77 - (50%)
Similarity:55/77 - (71%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEA 65
            |.|......|.|||...:.|::||:|||||::|:.|||||:|.::|..|:|||::|.|:|||.||
Yeast     1 MPKVYSYQEVAEHNGPENFWIIIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIGHSDEA 65

  Fly    66 REMLKKYYIGDL 77
            ..:||..||||:
Yeast    66 LRLLKGLYIGDV 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 4..77 CDD:278597 36/72 (50%)
CYB5NP_014288.3 CYB5 <1..119 CDD:227599 39/77 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I1836
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1567
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 1 1.000 - - otm46547
orthoMCL 1 0.900 - - OOG6_100589
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 1 1.000 - - X609
TreeFam 1 0.960 - -
109.750

Return to query results.
Submit another query.