DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and SCS7

DIOPT Version :9

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_013999.1 Gene:SCS7 / 855315 SGDID:S000004885 Length:384 Species:Saccharomyces cerevisiae


Alignment Length:85 Identity:42/85 - (49%)
Similarity:53/85 - (62%) Gaps:8/85 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKEIRL---ATVNEHNKATDLWVVIDN-KVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVG-- 60
            ||.:.|   .||.|||.|.|.||...| |:||||:|..|||||:||::|.||:|.|:...|..  
Yeast     6 SKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDVH 70

  Fly    61 -HSSEAREMLK-KYYIGDLA 78
             ||..|.|:|: :|.||.||
Yeast    71 EHSDSAYEILEDEYLIGYLA 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 4..77 CDD:278597 38/80 (48%)
SCS7NP_013999.1 CYB5 31..224 CDD:227599 30/60 (50%)
FA_hydroxylase 149..380 CDD:412761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.