DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and NIA2

DIOPT Version :10

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_174901.1 Gene:NIA2 / 840630 AraportID:AT1G37130 Length:917 Species:Arabidopsis thaliana


Alignment Length:130 Identity:38/130 - (29%)
Similarity:66/130 - (50%) Gaps:27/130 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEAR 66
            :|...::.|.:||.|...|:::...:||.|:|.::||||.:|::..||.|.|:.|..: ||.:|:
plant   542 AKMYSMSEVKKHNSADSCWIIVHGHIYDCTRFLMDHPGGSDSILINAGTDCTEEFEAI-HSDKAK 605

  Fly    67 EMLKKYYIGDLAA------------------------ADIKKKSPISCRHVALALGAAFIGISLV 107
            :||:.|.||:|..                        |.|.:.:|:  |::||....|.:.:.||
plant   606 KMLEDYRIGELITTGYSSDSSSPNNSVHGSSAVFSLLAPIGEATPV--RNLALVNPRAKVPVQLV 668

  Fly   108  107
            plant   669  668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 6..78 CDD:459698 27/71 (38%)
NIA2NP_174901.1 PLN02252 1..917 CDD:215141 38/130 (29%)

Return to query results.
Submit another query.