DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and CB5-E

DIOPT Version :10

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_200168.1 Gene:CB5-E / 835438 AraportID:AT5G53560 Length:134 Species:Arabidopsis thaliana


Alignment Length:92 Identity:41/92 - (44%)
Similarity:60/92 - (65%) Gaps:4/92 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEARE 67
            |.:....|::|||..|.|::|..||||||.|..:||||:|.|:...|:|||..|.|||||..||:
plant     6 KVLSFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSDTARD 70

  Fly    68 MLKKYYIGDLAAADIKKKSPISCRHVA 94
            |:.||:||::.::.:    |.:..:||
plant    71 MMDKYFIGEIDSSSV----PATRTYVA 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 6..78 CDD:459698 37/71 (52%)
CB5-ENP_200168.1 Cyt-b5 9..81 CDD:459698 37/71 (52%)

Return to query results.
Submit another query.